Recombinant Proteins
- (2)
- (970)
- (1)
- (23,543)
- (5)
- (1)
- (1)
- (67)
- (219)
- (4,425)
- (23)
- (1)
- (4)
- (2)
- (13)
- (21,461)
- (3)
- (4)
- (3)
- (1)
- (2)
- (4)
- (14)
- (71)
- (2)
- (2)
- (2)
- (1)
- (3)
- (2)
- (1)
- (3)
- (4)
- (1)
- (1)
- (1)
- (3)
- (254)
- (22,606)
- (1)
- (1)
- (2)
- (1)
- (13)
- (26,166)
- (266)
- (32)
- (3)
- (708)
- (14)
- (2)
- (1)
- (8)
- (1)
- (5)
- (1)
- (108)
- (1)
- (3,782)
- (1,408)
- (3)
- (4)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (14)
- (138)
- (48)
- (6)
- (17)
- (2)
- (1)
- (4)
- (81)
- (12)
- (2)
- (3)
- (80)
- (4)
- (113)
- (96)
- (19)
- (1)
- (1)
- (4)
- (1)
- (1,525)
- (2)
- (1)
- (3)
- (18)
- (48)
- (3)
- (1)
- (2)
- (9)
- (27)
- (2)
- (201)
- (1)
- (4)
- (1)
- (2)
- (114)
- (44)
- (2)
- (1)
- (1)
- (4)
- (1)
- (1)
- (3)
- (1)
- (23,710)
- (6)
- (3)
- (1)
- (1)
- (63)
- (6)
- (2)
- (7)
- (5)
- (1)
- (2)
- (1)
- (1)
- (6,728)
- (6)
- (4)
- (1)
- (3)
- (1)
- (3)
- (2)
- (13)
- (17)
- (1)
- (3)
- (3)
- (4)
- (25,926)
- (240)
- (1)
- (3)
- (286)
- (2)
- (61,756)
- (1)
- (15)
- (1)
- (2)
- (45,218)
- (5,703)
- (245)
- (168)
- (56)
- (3,364)
- (2)
- (1)
- (2)
- (1)
- (21)
- (559)
- (96)
- (2)
- (1)
- (1)
- (2)
- (1)
- (27)
- (1)
- (8)
- (15)
- (1)
- (72)
- (1)
- (1,050)
- (1)
- (3)
- (16)
- (1)
- (3)
- (1)
- (1)
- (1)
- (8)
- (1)
- (4)
- (1)
- (1)
- (26,022)
- (5)
- (1)
- (4)
- (582)
- (2)
- (1)
- (1)
- (3)
- (1)
- (1)
- (14)
- (32)
- (24)
- (1)
- (2)
- (16)
- (120)
- (9)
- (2)
- (1)
- (2)
- (2)
- (2)
- (23)
- (5)
- (3)
- (3)
- (2)
- (14)
- (23,574)
- (1)
- (48)
- (7)
- (1)
- (3)
- (18)
- (2)
- (62)
- (1)
- (4)
- (2)
- (9)
- (59)
- (1)
- (2)
- (3)
- (1)
- (391)
- (1)
- (3)
- (2)
- (1)
- (1)
- (1)
- (3)
- (2)
- (6)
- (19)
- (7)
- (2)
- (2)
- (3)
- (45)
- (1)
- (1)
- (1)
- (2)
- (5)
- (1)
- (1)
- (1)
- (1)
- (2)
- (8)
- (2)
- (3)
- (38,959)
- (1)
- (11)
Filtered Search Results
Novus Biologicals™ Recombinant Human DUSP19 His Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
R&D Systems™ Recombinant Mouse Lysyl Oxidase Homolog 2 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ alcohol dehydrogenase 1A Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | SDS-PAGE |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| For Use With (Application) | SDS-PAGE |
| Source | Human |
Novus Biologicals™ dUTPase Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purification Method | Protein |
| Purity or Quality Grade | >90% |
| Conjugate | Unconjugated |
| Common Name | dUTPase |
| Molecular Weight (g/mol) | 21.6kDa |
| Gene ID (Entrez) | 1854 |
| Immunogen | dUTPase 70-252 aa MGSSHHHHHHSSGLVPRGSHMASTVGAAGWKGELPKAGGSPAPGPETPAISPSKRARPAEVGGMQLRFARLSEHATAPTRGSARAAGYDLYSAYDYTIPPMEKAVVKTDIQIALPSGCYGRVAPRSGLAAKHFIDVGAGVIDEDYRGNVGVVLFNFGKEKFEVKKGDRIAQLICERIFYPEIEEVQALDDTERGSGGFGSTGKN |
| Storage Requirements | Store at -80°C. Avoid freeze-thaw cycles. |
| Concentration | 1mg/mL |
| For Use With (Application) | ELISA,SDS-PAGE |
| Source | Human |
R&D Systems™ Recombinant Human S100A1 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
| Conjugate | Unconjugated |
|---|---|
| Form | Powder |
| Product Type | Recombinant Proteins |
| For Use With (Application) | Organoid Expansion |
| Species | Human |
| Recombinant | Recombinant |
Gibco™ Human FGF-9 Recombinant Protein
Recombinant Protein
Non-distribution item offered as a customer accommodation; additional freight charges may apply.
Learn More
| Purity or Quality Grade | ≥95% by SDS-PAGE and HPLC |
|---|---|
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Molecular Weight (g/mol) | 23.4 kDa |
| Common Name | FGF9 |
| Gene Symbol | FGF9 |
| Activity | ED50 ≤ 10 ng/mL; determined by the dose-dependent proliferation of Balb/c 3T3 cells. |
| Endotoxin Concentration | <0.1 ng/μg |
| Storage Requirements | -20°C |
| Sequence | Human FGF-9 recombinant protein contains 206 amino acids |
| Expression System | E. coli |
| For Use With (Application) | Bioactivity |
| Name | Human FGF-9 |
| Accession Number | P31371 |
| Regulatory Status | RUO |
| Purification Method | Purified |
| Gene Alias | Eks; elbow knee synostosis; FGF; Fgf9; FGF-9; Fibroblast growth factor; Fibroblast growth factor 9; fibroblast growth factor 9 (glia-activating factor); GAF; glia activating factor; glia-activating factor; HBFG-9; HBGF-9; Heparin-binding growth factor 9; M-FGF-9; SYNS3 |
| Product Type | Protein |
| Gene ID (Entrez) | 2254 |
| Formulation | Protein with no preservative |
| Recombinant | Recombinant |
Novus Biologicals™ Recombinant Human MBL-2 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >90%, by SDS-PAGE |
| Molecular Weight (g/mol) | 25.1 kDa |
| Gene ID (Entrez) | 17195 |
| Formulation | Phosphate Buffered Saline (pH 7.4) containing 10% glycerol. |
| Gene Symbol | Mbl2 |
| Endotoxin Concentration | < 1.0 EU per 1μg of protein (determined by LAL method) |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1 mg/ml |
| Cross Reactivity | MBL-2 |
| For Use With (Application) | SDS-PAGE |
| Species | Human |
| Source | Baculovirus |
R&D Systems™ Recombinant Mouse Angiopoietin-like 3 (aa 17-220) Biotin
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
R&D Systems™ Recombinant Mouse Vasorin/SLIT-like 2 Protein
Extensive quality control produces industry leading bioactivity and lot-to-lot consistency that instills confidence in results and ensures reproducibility.
Novus Biologicals™ AK3L1 Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
Novus Biologicals™ Recombinant Mouse DDT Protein
Small and Specialty Supplier Partner
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Small and/or specialty supplier based on Federal laws and SBA requirements.
Learn More
Highly purified. Generating reliable and reproducible results.
| Regulatory Status | RUO |
|---|---|
| Purity or Quality Grade | >95%, by SDS-PAGE |
| Molecular Weight (g/mol) | 15.5 kDa |
| Gene ID (Entrez) | 1652 |
| Formulation | 20mM Tris-Hcl buffer (pH8.0) containing 10% glycerol |
| Gene Symbol | DDT |
| Storage Requirements | Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Concentration | 1 mg/ml |
| Cross Reactivity | DDT |
| For Use With (Application) | SDS-PAGE |
| Species | Mouse |
| Source | E. coli |